SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g112300.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g112300.2.1
Domain Number 1 Region: 26-70
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000559
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g112300.2.1
Sequence length 83
Comment genomic_reference:SL2.40ch03 gene_region:56796725-56798610 transcript_region:SL2.40ch03:56796725..56798610- functional_description:"Os11g0444900 protein (Fragment) (AHRD V1 ***- Q0ISX9_ORYSJ); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MLNSINGTQVIKFLYSYGGRIVPRRSDGKLRYIGGFTRVLSVEKPISFSELMVKFGESCG
SSMSLKWDPFGILSWQKGLEQLA
Download sequence
Identical sequences K4BK84
Sopim03g112300.0.1 Solyc03g112300.2.1 Solyc03g112300.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]