SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g118910.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g118910.1.1
Domain Number 1 Region: 26-153,419-537
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 6.8e-83
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00068
Further Details:      
 
Domain Number 2 Region: 218-392
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.71e-45
Family Group II chaperonin (CCT, TRIC), apical domain 0.0003
Further Details:      
 
Domain Number 3 Region: 157-224,385-418
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.28e-28
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g118910.1.1
Sequence length 539
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch03 gene_region:61737005-61738624 transcript_region:SL2.40ch03:61737005..61738624- go_terms:GO:0044267,GO:0006457 functional_description:"T-complex protein 1 subunit delta (AHRD V1 ***- B9S339_RICCO); contains Interpro domain(s) IPR012717 T-complex protein 1, delta subunit "
Sequence
MASPAVVSAPRSAASSSKTETFVDNKRKDDIRMANIAAAQAVANAVRTSLGPKGMDKMIS
TANGEVIITNDGATILNKMEVLQPAAKFLVELSKSQDVVAGDGTTTVVVIAGALLKQCLS
LLSSGIHPTVVSDSLHKASTKAVEVLTAMALPVELTDRDSLVKSASTALNSKVVSQYSTL
LAPLAVDSVLSVVDPEKPEIVDLRDIRIVKKLGGTVDDTELVKGLVFDKKVSHASGGLTR
VEKAKIGVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLI
QKSILRDAVTELSLHYLSKAKIMVIKDVERDEIEFITKTLNCLPIANIDHFRAEKLGHAD
LVEEISLGDGGKIVKITGIQDMGRTTSVLVRGSNQLVLDEAERSLHDALCVVRCLVNKRF
LIAGGGAPEIELSRQLGAWAKVLQGMEGYCVRSFAEALEVVPYTLAENAGLNPIAIVTEL
RNRHAQGEINTGINVRKGQITNILEENVVQPLLVSTSAITLATECVRMILKIDDIVTVR
Download sequence
Identical sequences K4BM40
Sopim03g118910.0.1 XP_004235777.1.44838 Solyc03g118910.1.1 Solyc03g118910.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]