SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g121060.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g121060.2.1
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000137
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g121060.2.1
Sequence length 287
Comment genomic_reference:SL2.40ch03 gene_region:63350693-63353201 transcript_region:SL2.40ch03:63350693..63353201+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 *-** ARFI_ARATH); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MEGYSQKWLMQRGEEINHGNSEEKKLELRLGPPNGDWSCGEKDESFYPFSYMSTTKGNNR
DNHAQNFSSFLQLQSTAQKQSQRVQESVCTKTADLQSTEKKKAFSQTATVQNSAQKRTAP
APVVGWPPIRSFRKNLASSSSVKSASETQNVVPNKSANKKPMEICQKGLFVKINMDGIPI
GRKVDLKAYDSYHKLSSAVDQLFRGLVAAQNDSSAGGNNEKKEDEEKAISGLLDGSGEYT
LVYEDNEGDRMLVGDVPWHMFVSTVKRLRVLKSSELSTLTRATKQLT
Download sequence
Identical sequences G9HPX0
Solyc03g121060.2.1 Solyc03g121060.2.1 Sopim03g121060.0.1 NP_001266088.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]