SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g123570.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g123570.2.1
Domain Number 1 Region: 1489-1753
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.54e-78
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00073
Further Details:      
 
Domain Number 2 Region: 434-606
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.19e-44
Family Group II chaperonin (CCT, TRIC), apical domain 0.00028
Further Details:      
 
Domain Number 3 Region: 28-104
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 390-440,599-626
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000824
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g123570.2.1
Sequence length 1782
Comment genomic_reference:SL2.40ch03 gene_region:64438202-64447839 transcript_region:SL2.40ch03:64438202..64447839+ go_terms:GO:0035091,GO:0016308 functional_description:"Phosphatidylinositol-4-phosphate 5-kinase family protein (AHRD V1 **-* D7L328_ARALY); contains Interpro domain(s) IPR016034 Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup "
Sequence
MDRKSLDLLGLLKSWIPQRDSSADVSRDFWMPDESCRVCYECDSLFTLFNRRHHCRLCGR
VFCAKCTSNSIPVPPREPRLLQEECEKVRVCHYCYKQWKQGFNHAIQVSNLDSNTFLSAA
SFISVKSSGTGDSSSSSITLVPQSPVLSSCKSAVMESSLVRQNNVATAKGSTDPADIGIR
DPLTNQFSFCTTRSYDEDDEYGVYQLDSQGKHYSQTNGYFSYDDNGKDYGSNKVHPNGEA
TDEKSVSSLSSQNNFETQASEEVQQIVKQDIGDECEASSSLYAAQDANLEPVDFENSGIL
WLPPEPEDEEDERDGMLFDDDDDDGDAAGEWGYLHASSSFGSGEYRGRDRSNEEQKNVVK
NVVDGHFRALVSQLMQVEKLVIGEEEDKESWLEIVTSLSWEAATLLKPDTSKGGGMDPGG
YVKVKCIASGHRSDSAVVKGVVCKKNVAHRRMTSKVEKARIVILEGALEYQRVSNHLSSF
ATLLQQEMDHLKMAVARIDAHNPDVLLVEKSVSRYAQEYLLEKDISLVLNIKKPVLERIA
RCTGGQIVHSVDHLSSQKMGYCDMFHVQKFLEEHDTAGEIGKKLVKTLMYFEGCPKPLGC
TILLRGANRDELKKVKRVVQYSIFAAYHLALETSFLADEGASLPELPLDSPITVALPDKP
LTIDRSISTIPGFMIPADERTLGPLSGSEPQRSMSAPPTGLVKAVSNCAQKMGVLESPGL
CATKDNFSSFCKPSLDHESEIGIMDMMKCSEVKASVANDVQDAHGNKFLSTSFGPSQEVD
QDMLSQSVQNDCNTMDVNQGGEDAPDDLTSLKKEFSPSPSDNQSILVSLSSRCVWKGTVC
DKSRLFRIKYYGNVDKPLGRFLRDQLFDQSYRCHSCEMPSEAHVQCYTHRQGTLTISVKK
LLEVLLPGEKEGKIWMWRRCLKCPRDNKGFPPATRRVVMSDAAWGLSLGKFLELSFSNHA
AASRVANCGHSLHRDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFNYENQEWIEHEV
NEVIFRAELLFAEVLNAIRLLVEKRSGRQLNSSINVPEARRQISDLEGMLQKEKQEFEES
LQRILMEEVKKGQSVDILEINRLRRQLLFQSYVWDHRLVYAASMDDKSHWFSGDVTSLEP
EKPLVCDDKSTDLDNCADPSNCPNSSESVPAILKAGENGDEGRSVGQNSHVDAVHQESAV
DFDADCAIEKPPGLPVATKSFCGSHPEESILQRRRALSAGQFPNMESLSDTLEAAWTGET
TSGVVVIKGDTCKSSEPHLVNTLTTGMAEKVYTEDHATMLSQTPSLLASKGSENMEDAGS
WLGVSFISFYRTLNKNFLPSAQKLDPLGGYNPVYISSFRESDAQSGARLLLPVGVNDTVI
PVYDDEPTSIISYALASHDYHAQLSGELEKSKDASLDSNFSFHSLDSSNLHSPQSVDEMF
LESYRSLGSMDESLLSLPISRSSFDLDPLSYTKTLHARVSFGDDGSLGKVKYSVTCYYAK
RFEALRRICCPSEMDFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFMK
FAPEYFKYLSESIITGSPTCLAKILGIYQVSSKQLKGGKESKMDVLVMENLLFGRKLARL
YDLKGSARSRYNPDSSGSNKVLLDQNLIESMPTSPIFVGNKAKRLLERAVWNDTAFLAAV
DVMDYSLLVGVDEEKNELVVGIIDFMRQYTWDKHLETWVKASGILGGPKNASPTIISPKQ
YKKRFRKAMTTYFLMVPDQWSPTSVVPSKSLTNLCDENMQGG
Download sequence
Identical sequences K4BN56
Solyc03g123570.2.1 Sopim03g123570.0.1 Solyc03g123570.2.1 XP_004235530.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]