SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g007650.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g007650.2.1
Domain Number 1 Region: 1377-1645
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.83e-82
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00021
Further Details:      
 
Domain Number 2 Region: 394-566
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.19e-42
Family Group II chaperonin (CCT, TRIC), apical domain 0.00032
Further Details:      
 
Domain Number 3 Region: 4-70
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000224
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0084
Further Details:      
 
Weak hits

Sequence:  Solyc04g007650.2.1
Domain Number - Region: 349-400,559-582
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0174
Family GroEL-like chaperone, intermediate domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g007650.2.1
Sequence length 1654
Comment genomic_reference:SL2.40ch04 gene_region:1324630-1333026 transcript_region:SL2.40ch04:1324630..1333026- go_terms:GO:0044267,GO:0046488 functional_description:"Phosphatidylinositol-4-phosphate 5-kinase family protein (AHRD V1 ***- D7L328_ARALY); contains Interpro domain(s) IPR016034 Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup "
Sequence
MDVDSGKICWECKMRFTDSCNKYNCQICNGVFCGDCCTHSNGCFDVVASGLKGEVVGIKS
CKFCSELRTWNNGVGKYRDKTCPFESPRESTESTSTNFNSDRFDGYSSHTPVKSSFTTFS
GHPFPISLRHSPSRSDEDEGGDSTRQFFSPSSSYFHDTSDIDSSSVSTRHEFYSLRSAGS
SPSDSPSRIRFTSNRAGHSVQQDQNEIPRSQNNGPFDQEASYVLRRLEKGTKDPETADAS
VENLSVYHNQLEKQQKPFDLRNSDFIWFPPPLDEDDEDENNFFTYDDEDDEIGESAAIFS
SSANLTTMDKEHVDHKEPMKAVVQGHFRALVLQLLQGEGVKSGKESGSDDWIDIVTSLAW
QAANFVKPDTSEGGSMDPGYYVKVKCVASGSPRESTLVKGVVCTKNIKHKRMNSHCKNAR
LLLLGGALEYQKIPNQLASFNTLLQQEREHLKMIVSKIEAHHPNVLLVEKSVSSHAQEYL
LKKEISLVLNVKRPLLERIARCTGALITPSIDNIAMARLGYCELFHLEKVSEEHEPPNQF
NKKPSKTLMFFDGCPTRLGCTVLLRGLCCEELKKVKNVFQYAVFAAYHLSLETSFLADEG
ASLPKVSVAIPEMTSADNAISVISHTASSARHHRVGNGPHNLVGSASCNADVGLPVSLVK
HHYPPFKDPTTLDDTIEGSLVTLGQGEFQPSESPDLSKFEISDEFEPSNESYSAADSRQS
ILVSFSSRCILNGNVCERSRLLRIKFYGSFDKPLGRFLLDDLFGQIPSCQSCKEPAEDHV
ICYTHQQGNLTIHIRRQHSVKLPGEWDNKIWMWNRCLKCARIEGVPPATPRVVMSDAAWG
LSFGKFLDLSFSNNATANRVAGCGHSLQRDCLRFYGCGSMIAFFHYSPIDILSVCLPPST
LMFSSYEEQEWLRKETDELLCKAKALYAEISSAIRRIEEKRSSLEHDLSDKPELDDCIME
LKDLLMKEKSDYHDLLQTADAETSEQAQAVVDILELNRLRHSLVIASHVWDRRLLSVESL
FQETSGSEYTGSCSELIDWRNNVFLKNGPLEHVYEETEPEFSNLDEYPQKPFQSEEEETH
GSPYRLEESMFTSCEFKKTQDKHMEGENAVNGTPLERAPSAGSVLSDQIDSAWTGTDRSP
KKALLDMKLQRNGSEAASFRQLSQLDYPPIARVKSPARVNSFDSALRLQERIRKGLPPSS
LHLSAIRSFHASGDYRNMIRDPVISVQRTYSLMSPNEAQKFNLLMNSSPSFISYASLIHD
GPRLMVPHNGFNDIVIAVYDNEPTSIISYALASKQYKERVTDKPNVSERGWNTNDIRKEN
GVACNVSRWQSFGSLDMDYIHHGSHGSEDASSTISSIFADSKTSPHLRISFEDESSNAGG
KVKFSVTCYFAKQFDALRKRYCPDELDFIRSLSRCKRWSAQGGKSNAYFAKSLDERFIIK
QVQKTELESFEEFGPNYFKYLTDSVSSRSPTCLAKVLGIYQVSVKHLTGGRETKMDLIVM
ENLFFGRKISKVYDLKGSLRSRYNADKTGANSVLLDLNLLEILRTKPIFLGSKAKRSLER
AIWNDTSFLASVDVMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETWVKASGILGGP
KNALPTIVSPIQYKKRFRKAMTSYFLTLPDQWSS
Download sequence
Identical sequences K4BNS2
Sopim04g007650.0.1 Solyc04g007650.2.1 Solyc04g007650.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]