SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g015500.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g015500.2.1
Domain Number 1 Region: 40-141
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-24
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g015500.2.1
Sequence length 217
Comment genomic_reference:SL2.40ch04 gene_region:5717054-5718455 transcript_region:SL2.40ch04:5717054..5718455+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At3g18960 (AHRD V1 *-*- Y3896_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MVDRREDHLAETAARREKQPAGMASRQGQGEPRPVDIPERTPHFFKIILSPHASKLHIPD
EFVTEHGANLGDIVLLEVPNGVVWKVRLLNSSGMVWLNEGWNKFKEYYSIGCGYFLLFRY
KGNSQFCVFIFDLSASEIEYPPGPNEDMTPENRSVLCVRLEENGINLPPPGEPPKEKRIN
LTPPNDPPEEDVIYLPPPGIYTMEELSLISMPSRPKV
Download sequence
Identical sequences K4BQ52
Solyc04g015500.2.1 Solyc04g015500.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]