SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g054470.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc04g054470.2.1
Domain Number - Region: 297-358,541-563
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 0.000586
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g054470.2.1
Sequence length 639
Comment genomic_reference:SL2.40ch04 gene_region:51708018-51719444 transcript_region:SL2.40ch04:51708018..51719444+ functional_description:"Myosin class II heavy chain (ISS) (AHRD V1 *-*- Q014V4_OSTTA)"
Sequence
MLRRSILRLSAGQSVKRIPAEVITQVPSYLFSRREFSVSPKQNGPPRGPGSTGKPKETVS
LLPRFIIGSVALSAGFFAAYQTGYLDKYLIKEPHSSPELARDETGLQGVKELKESSEVSQ
DSETLGRPDAGSKFVESDSPEQTYQSIGIQQDLSGSEEPTATGSESQFQVNDSSEITGGE
ANYTEVKELSPSSHQENVSPDETRLTSTQSPEDTLDMKSPEVSTDAVQSKAIEITPTPTQ
ADTLQKENEASVMSPEHVISQAKMEDAPQHEEKPSSLLDEYYLRNGVGATPTTSSDKKMV
VEDLGDSYISKDGKLVLDVLQVIHETESRQAELDARLFAEEKKYMKERYEKELKDARARE
LMYAEREALLDKELKKERAKAIAALKSLKEKLEEEHKTELEEKEDEAELKLKKAQELGKA
QLDAAIASEKASQIEKMAEANLHINALCMAFYARSEEVRQTHSVHKLALGVLALEDALSR
GLPIQKELENLHTSLEGIDNNSLLDVVLSSLPEETQRYGSDTVLQLNHKFDTLKGTLRHF
SLIPPGGGGILTHSLASVASWLKVREAGQSGDGIESLINKVESFLAQGKLSEAADALEKG
LKDTHAAEIVDDWVKRARNRAITEQALTLLQSYATTIST
Download sequence
Identical sequences K4BSK2
Solyc04g054470.2.1 Solyc04g054470.2.1 XP_004237426.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]