SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g076820.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g076820.1.1
Domain Number 1 Region: 57-148
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.89e-22
Family PB1 domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g076820.1.1
Sequence length 474
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch04 gene_region:59289748-59291172 transcript_region:SL2.40ch04:59289748..59291172- functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7MPG4_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MENFSYSSYPDSVNSSPRSREIDCENASWDDQPPSSNSNYKVKFMCSYGGKILPRPHDNQ
LAYVSGETKILSVDRNIRFSNLVAKLSSLSDCDVCFKYQLPGEDLDALISVTNDEDLEHM
MLEYDRLYRGTAKPARLRLFLFPLSTPATSTFGSTDSKTESQWFVDALNSVQLQNLDVNS
PTAVSSAPAPANNPDFLFGLDKGQVQQQQPPPVKVQDPTPSPPVPEVFVKEFTGSDAGSE
DRHIIGENVISPADYQRQIHEMQRLQQHISNQEQAMYNRKIEESIPRVYPGENYQQKAPP
PQQTAVPVTNPASFWPERHTTTGPYPASAVQTEQPVYIVQTPAGVYQTPAMRPVTSQIGG
QAYYGMQRMMPEVYRDQPVYGGVPPQPTIQQPKMGGVYTSENMGMVRPHAPPEPTYTQVG
YDSVGRQVYYTAPAGVMQHQMQHPAVAAAAAVAAVDGRQSGGALNPDGRIIGKP
Download sequence
Identical sequences K4BUC0
XP_004238032.1.44838 Solyc04g076820.1.1 Solyc04g076820.1.1 Sopim04g076820.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]