SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g009790.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g009790.1.1
Domain Number 1 Region: 205-304
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-32
Family B3 DNA binding domain 0.00000658
Further Details:      
 
Domain Number 2 Region: 71-127
Classification Level Classification E-value
Superfamily DNA-binding domain 5.36e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g009790.1.1
Sequence length 395
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch05 gene_region:3987084-3988271 transcript_region:SL2.40ch05:3987084..3988271- go_terms:GO:0003677,GO:0016564 functional_description:"Transcription factor (AHRD V1 *-** D6MKM9_9ASPA); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEGSISSIDQESTTSDSLSIAPAASSSTMIKSSTTIKLPPESGLCRMGSGTSVIIDAENG
VEAESRKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEENEAARAYDIAAQRFRGR
DAVTNFKPLLENQESDDMEIAFLNSHSKAEIVDMLRKHTYIDELEQSKRLFGFTKDGMIK
RKDGLVISSFFGSTNDKVNCKAREQLFEKVVTPSDVGKLNRLVIPKQHAEKHFPLQNGNN
SKGVLLNFEDLNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTSGDK
QLYIDFKAKNVGNTSMVVTNQVQAQVQVPLVQMVRLFGVNICKVPANVSNVVIDNNNNNN
NNNMTSWGGGKRRMEMELLTFESCRKKQRVIIDAL
Download sequence
Identical sequences K4BXF3
Solyc05g009790.1.1 Sopim05g009790.0.1 Solyc05g009790.1.1 NP_001307390.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]