SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g013530.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g013530.2.1
Domain Number 1 Region: 29-118
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.29e-26
Family PB1 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g013530.2.1
Sequence length 219
Comment genomic_reference:SL2.40ch05 gene_region:6766537-6768182 transcript_region:SL2.40ch05:6766537..6768182+ functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7LRK8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MVSPSINSHNFPLKFLCSYGGKIIPRQTDGKLRYYGGETRVLSVDRSISFTELLVKLGEM
CGSSVSLRCQLPNEDLDALVSITSDEDLANLIEEYDRVSKISSFLKMRAFLYPPKSTKKV
VSPTPSIASTSSTNSTTISNPDVTSSPSSFCSTVTSPPTSTRHHDCPRPYKKMARNSLDE
TISGRIRHIRTRSSPVMFPICHEKVTAKIPQYVYDDEIK
Download sequence
Identical sequences K4BY74
Sopim05g013530.0.1 Solyc05g013530.2.1 Solyc05g013530.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]