SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g013990.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g013990.2.1
Domain Number 1 Region: 21-151,412-531
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 7.33e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0005
Further Details:      
 
Domain Number 2 Region: 217-385
Classification Level Classification E-value
Superfamily GroEL apical domain-like 6.8e-53
Family Group II chaperonin (CCT, TRIC), apical domain 0.00014
Further Details:      
 
Domain Number 3 Region: 156-221,375-412
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 6.1e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc05g013990.2.1
Sequence length 535
Comment genomic_reference:SL2.40ch05 gene_region:7492470-7499923 transcript_region:SL2.40ch05:7492470..7499923+ go_terms:GO:0051082 functional_description:"T-complex protein 1 subunit epsilon (AHRD V1 ***- B6TSC6_MAIZE); contains Interpro domain(s) IPR012718 T-complex protein 1, epsilon subunit "
Sequence
MALAFDEFGRPFIILREQEQKTRLRGLDAQKANISAGKAVARILRTSLGPKGMDKMLQSP
DGDVTITNDGATILEQMDVDNQIGKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAEKLL
ERGIHPIRIAEGYEMASRIAVEHLERVAHKFEFGQNDVEPLVQTCMTTLSSKIVNRCKRS
MAEIAVKAVLAVADLERKDVNLDLIKVEGKVGGKLEDTELIYGIIVDKDMSHPQMPKQIE
DAKIAILTCPFEPPKPKTKHKVDIDTVEKFQTLRLQEQKYFDDMVQKCKDVGATLVICQW
GFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRIVPRFQELTPEKLGKAGIVREKSF
GTTKDRMIYIEHCANSRAVTIFIRGGNKMMIEETKRSIHDALCVARNLIRNNSIVYGGGS
AEISCSIAVEAAADKHPGVEQYAIRAFADALDAVPMALAENSGLQPIETLSAVKSQQIKE
NNPCCGIDCNDVGTNDMREQNVFETLIGKQQQILLATQVVKMILKIDDVITPSEY
Download sequence
Identical sequences K4BYC0
Solyc05g013990.2.1 Solyc05g013990.2.1 XP_004239159.1.44838 XP_015076254.1.21931 Sopim05g013990.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]