SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g053470.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g053470.2.1
Domain Number 1 Region: 217-407
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.59e-78
Family GroEL-like chaperone, apical domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 37-165,437-553
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.33e-74
Family GroEL chaperone, ATPase domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 169-237
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.33e-21
Family GroEL-like chaperone, intermediate domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g053470.2.1
Sequence length 573
Comment genomic_reference:SL2.40ch05 gene_region:62706122-62712174 transcript_region:SL2.40ch05:62706122..62712174+ go_terms:GO:0005524,GO:0005507 functional_description:"chaperonin (AHRD V1 ***- D2LE93_RHOVA); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MYRFAAKLASKSRVARSSTQQVGSRLNWSRNYAAKDIKFGVEARGIMLQGVEQLADAVKV
TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDAAGDGT
TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQVGT
ISANGEREIGEIIARAMEQVGKEGVITIQDGKTLLNDLQVVEGMKLDRGYISPYFITNEK
NQKCELDDPLILIHEKKISSINAIVKVLELALKRQRPLLIVSEDVESEALATLILNKLRA
GIKVCAIKAPGFGENRKANLQDLAALTGGQVITEELGMNIENVELEMLGKCKKVTISKDD
TVVLDGAGEKKAIEERCEQIRSAIELSTSDYDKEKLQERLARLSGGVAVLKVGGASEVEV
GEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELDSLPTANFDQKIGVQIIQNALKT
PVYTIASNAGVEGSVVVGKLLEQDNPDLGYDAAKGEYVDMVKAGIIDPLKVIRTALVDAA
SVSSLLTTTEAVIVELPKDEKAAPAMPGGGMDY
Download sequence
Identical sequences K4C227
Solyc05g053470.2.1 Solyc05g053470.2.1 XP_004239874.1.44838 XP_015076261.1.21931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]