SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g034140.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g034140.1.1
Domain Number 1 Region: 79-175
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-24
Family B3 DNA binding domain 0.0055
Further Details:      
 
Weak hits

Sequence:  Solyc06g034140.1.1
Domain Number - Region: 368-428
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00523
Family Sec2 N-terminal region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g034140.1.1
Sequence length 445
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch06 gene_region:20397157-20399301 transcript_region:SL2.40ch06:20397157..20399301- go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os01g0234100 (AHRD V1 ***- Y1341_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MAISSLYSSKKSPALSSSKKKAQQIKKKTLAPTKTNKVVNGGTKKVQICLEKKTLKHSSV
DVNSSAMLRAAEVQANLPCQFPSFVKYMLPSHVSGGFWLGFPKRFCDCHLPKHDAIVVLV
DENDEESPTKYLIDKNGLSGGWRGFSIAHNLLEGDVLVFQLIQPSKFKVYIVRENCLTEI
DGAITLLNLDFRARPIKSDHDEEIKIFEAKEEKYLEPPVLDINQDDKIEEPMLLPNSDHD
PIADQCGNDSDNGSDVLEGIRFSESRVEFKDVKDYSGFNIIVDGLTIDSEVPALHIRTKY
YDLCRAQNSFLHDHLLAGLNVKLAAGMITETVNIADAIRACESWTPREYLDTWDNTLKGF
ECLGMNVGFLRARISKLDSLSSESKDVLESKKVELAEAKEEMRIIEEKVLKVKQVMKNVE
SEIEALTKKDANFELKFKALAASPW
Download sequence
Identical sequences K4C4N8
Solyc06g034140.1.1 XP_004240808.1.44838 Solyc06g034140.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]