SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g065520.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g065520.2.1
Domain Number 1 Region: 17-146,406-528
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 6.15e-88
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00055
Further Details:      
 
Domain Number 2 Region: 210-379
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.15e-48
Family Group II chaperonin (CCT, TRIC), apical domain 0.00024
Further Details:      
 
Domain Number 3 Region: 155-216,372-406
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.68e-26
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g065520.2.1
Sequence length 558
Comment genomic_reference:SL2.40ch06 gene_region:37287472-37295670 transcript_region:SL2.40ch06:37287472..37295670- go_terms:GO:0051082 functional_description:"T-complex protein eta subunit (AHRD V1 ***- A8HQ74_CHLRE); contains Interpro domain(s) IPR012720 T-complex protein 1, eta subunit "
Sequence
MSAMMQPQIILLKEGTDTSQGKAQLVSNINACMAVADVVRTTLGPRGMDKLIHDDKGNTT
ISNDGATIMKLLDIIHPAAKILVDIAKSQDSEVGDGTTTVVLLAGEFLKEAKPFVEEGVH
PQNLIRSYRTASNMAIEKVKELAVSIEGKSLEEKKSLLAKCAATTLSSKLIGGEKEFFAS
MVVDAVLAIGTDDRLNMIGIKKVPGGTMRDSFLVNGVAFKKTFSYAGFEQQPKKFVNPKI
LLLNIELELKSEKENAEIRLSDPAQYQSIVDAEWNIIYDKLDKCVKSGAKVVLSRLAIGD
LATQYFADRDIFCAGRVSEEDLQRVAAAAGGTVQTTVNNVIDEVLGSCEIFEEKQVGNER
FNIFSGCPSGKTATIVLRGGADQFIEEAERSLHDAIMIVRRAVKNSTVVPGGGAIDMEIS
RFLRHHARTIQGKSQLFINSYAKALEIIPRQLCDNAGFDATDVLNKLRQKHALPSGEGAP
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAA
SAMGGGRGRGRGRGMRRR
Download sequence
Identical sequences K4C7I1
Solyc06g065520.2.1 XP_004241812.1.44838 XP_015079524.1.21931 Solyc06g065520.2.1 Sopim06g065520.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]