SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g065540.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g065540.2.1
Domain Number 1 Region: 1235-1505
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.16e-79
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00013
Further Details:      
 
Domain Number 2 Region: 229-397
Classification Level Classification E-value
Superfamily GroEL apical domain-like 8.89e-24
Family Group II chaperonin (CCT, TRIC), apical domain 0.0024
Further Details:      
 
Weak hits

Sequence:  Solyc06g065540.2.1
Domain Number - Region: 184-235,390-421
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000287
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc06g065540.2.1
Sequence length 1559
Comment genomic_reference:SL2.40ch06 gene_region:37308987-37316738 transcript_region:SL2.40ch06:37308987..37316738- go_terms:GO:0035091,GO:0016308 functional_description:"Phosphatidylinositol-4-phosphate 5-kinase family protein (AHRD V1 **** D7KK53_ARALY); contains Interpro domain(s) IPR016034 Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup "
Sequence
MRKLENENSMHIDVRSSGTLCKFCGKKQDTTTCLISPTASLHSSNSSMSCYSDFSCEASS
DRRVNIDECSTESSQEDSCSKVDEDDYDESGVSCSYELDQFWVPPEPECCDDDMEDSVAN
CDDDECGDGWGKPTSLISLGDEGSGSYKFKEEKRKALEEVMNGKLKALVYDLIKSFGVAS
SGGDDWVDIVTSLSWEAASFVKPDSAEGKAMDPNKYVKIKCIRSGSPNQSQFIKGMVFKK
HAAHKHMPTKFEKPRLLLIEGALGLSSELSSFESMRQEKDSVVKSITDILERYQPNVILV
EKTVSRDIQESILKKGWTLVFDMKEHRLERVARCTVSPNFSSEILSGHKLRQCDSFHFQR
FVEEHDTFDDGGKRPSKTLLFIEGCPTHLGCTILLMGANSDELKKIKCVVRCAVIMAYNL
ILETSFLLDQKAMFSTISLSQVVNSTATDDPPAVSGEQGDSLLFEPYNPVLSGLSSLSAS
LKKVMGDNFPLCPTSGQSMPSCFIDNRSNEDDQEQTDTVVNQSDTDQKVTTCDDEVASEK
ERSHTPIVSQGESLESQVSGNMGNGVKSMDTESILVLISSRNASKGTMCAHGHFSRIKFY
QNFDIPLGSFLQQNLLSQKLPCKSCDGPPEAHIFYYAHYNKLLAIQVRSLPKDKGLPGER
EGKIWMWSRCGRCKFQSGSSKSTKRVLVSTGSRGFSFGKFLELRFSNSSLFNRLPVCGHS
LHRDFLYFFGLGHMVAVFKYSTVTTYSVALPPEKLEFSSSVNEEFLKKDFEDVNMKGIKM
FCDVEKALKAIESRFVGTTLNLQGSIRKFSEIEKMLKEERTQFEIGIQNVIMDGNRDVVM
YKLLILNRIRLELLLESCVWDRRLHSLLSSDCTAANPKTIDKSIIAINHMEQQEGSNVNG
HTKVYLERDDRALEDCPDLKIKLVEDSCGDDNSRTEATVGSRGDVLDDDCDLKPNVESSA
KVPIKETPVDTHDCGQDEPSNLSACNDGAEVTTAAKVNGNDFSLQDITVKSDLSDHCLFD
NESNLQLNLPSSIQLETDKPIAIGAGGTPDPIHSQRSRSLSSIFSNIENDEGWWTPFPEI
WCQYMEDLQRGHLPKLGSITNHDVESTAYKLITDMSAKLHIPLGSDKYIVSDYEDEFSSI
IACALALLKDLPIVCEDLGDDGRKDRGIDPKSYESSQGLMQMFSLASPHLSSTGSLDLTA
YHSSNMSEVARSSSLDGVDLLDSSVSFTAVQAEVSMGLGKLTGKYKYSVLCLYASQFRQL
RDRWCTSEVDFIASLSRCRRWDAKGGKSNSLFAKTVDDRFIIKEIKRAEFDSFLKFAPSY
FAYMDQCHAKRNQTCLAKILGIYQVNVRPRGGKETRHDLMVMENLSFGRITTRQYDLKGA
LHARFSAAGNGAGDVLLDQNFVNDMNVSPLYVGTRSKRALQRAVWNDCTFLKSINVMDYS
LLVGVDSQRHELVCGIIDYLRQYTWDKQLENWVKSSLVVPKNQLPTIVSPKEYYKRFRKF
IDTHFLSVPDNWCSQNSSNPCQLLRTVSSITPQSESDDGDSDQPKCTGEGEHKDAYSDA
Download sequence
Identical sequences K4C7I3
Solyc06g065540.2.1 XP_010322750.1.44838 XP_010322751.1.44838 Solyc06g065540.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]