SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g075010.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g075010.2.1
Domain Number 1 Region: 230-422
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.54e-67
Family GroEL-like chaperone, apical domain 0.00000653
Further Details:      
 
Domain Number 2 Region: 59-184,455-569
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.75e-65
Family GroEL chaperone, ATPase domain 0.0000483
Further Details:      
 
Domain Number 3 Region: 183-249
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000000000000128
Family GroEL-like chaperone, intermediate domain 0.001
Further Details:      
 
Domain Number 4 Region: 407-455
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000000000000366
Family GroEL-like chaperone, intermediate domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g075010.2.1
Sequence length 589
Comment genomic_reference:SL2.40ch06 gene_region:42927697-42932331 transcript_region:SL2.40ch06:42927697..42932331- go_terms:GO:0042623 functional_description:"chaperonin (AHRD V1 ***- B2IXD2_NOSP7); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MASANGMSTASILSSSSKQVGLKGRRVNQLQGQKFNNKASKSRLVVRANAKDIAFDQKSR
AALQAGIDKLVNVVGVTLGPRGRNVVLDEYDTPKVVNDGVTIARAIELADAMENAGATLI
REVASLTNDAAGDGTTTASVLAREIIKHGLLSVTSGANPVSLKRGIDKTVNALVAMLERR
ARPVKGRDDIKAIASISAGNDDEIGTMIADAIDKVGPDGVLSIESSSSFETTVRVEEGME
IDKGYISPQFITNQEKLVVEFENARVLVTDHDISAIKDIMPLLEKATQLRAPLLIIAGEV
TGEALATLIVNKLRGILNVAAIRAPGFGQRRKALLQDIAIVTGAEYQAADLCMPVESTPV
EALGFARKVTITKDSTTILADDVSKDEIQARISQIKKELDMSESVSDSEKLSERIAKLSG
GVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSNYVPAIKDNLE
DPDEKLGADIVQKALVAPASLIAQNAGVEGEVVVEKIKGSKWKMGYNAMTDKYEDLVEAG
VIDPAMVTRCALQNAASVAGMVLTTQAIVVDKKMPSAPAFAPPQGLPMM
Download sequence
Identical sequences K4C9L7
Sopim06g075010.0.1 Solyc06g075010.2.1 Solyc06g075010.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]