SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g082520.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g082520.2.1
Domain Number 1 Region: 314-418
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-21
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g082520.2.1
Sequence length 845
Comment genomic_reference:SL2.40ch06 gene_region:44592516-44602333 transcript_region:SL2.40ch06:44592516..44602333- go_terms:GO:0005515,GO:0016564 functional_description:"AP2 domain-containing transcription factor (AHRD V1 *--* B9HWL7_POPTR); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MGSMICMNELCRATTSVEWKKGWGFKSGGFAKLCYNCGSAFENFVFCETFHPDESGWREC
RTCRKPIHCGCIASKYLYEYLDYGGVTCIKCAHHLDGHSIRPIQIPGDDFPIGNLGSKSA
KPLGIENKIDENDFERRRFMQTNEPGQLFHTQRNDKKQDPMLPIGNVGTCFSNLNQQNIG
ASLFGKPDNERPSQGVKDMYDSINQPSLNFCLSTPIGTSSSGQPFLGGDVEGREQSKTSP
FQQGQRARHILPKPPKPSPTSGSESVKGMVSQARIARPPAEGRGGRSQLLPRYWPRITDQ
ELEQIAGDLKSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPINQSEGLPIRIQDIK
GKEWTFQFRFWPNNNSRMYVLEGVTPCIQNMQLQAGDTVIFSRIDPGGKLVMGFRKATNN
VDMQDPQTPNLPSGNGSGETSFPGMADNFPNGGRTSDDTMNRQVPMSEKKKARNIGSKNR
RLLMHADDAMELRITWEEIQELLRPSPTAKPNIVVVEDCEFEEYEEAPVFGKRTIFTARS
SGDQEQWAQCDSCSKWRRLPLHILLPAKWTCSDNIWDSRRCSCAAPDEISPRELEALLRV
GKDPKRRKLVENNEDLESSGLDALATVAASDMGDSIGDMGEPSVGATTKHPRHRAGCTCI
VCIQPPSGKGKHHPTCKCNVCLTVKRRFKTLMLRKKKKQSEREAELAQAKDQVPPKDESE
TDGMTSGVELLQMNHSENEHMNHSDNERNSNGDQVEEFGPGKGQLDLNCHPNRDDDMLAE
ATAGMSMTSLVNATNLPLEYLTQNRLESLGNSLLSQAASESEGHHPDNGFGKTADVESGG
KGAKA
Download sequence
Identical sequences K4CAB1
XP_004242480.1.44838 XP_010323114.1.44838 XP_010323115.1.44838 XP_010323116.1.44838 Solyc06g082520.2.1 Solyc06g082520.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]