SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g084070.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g084070.2.1
Domain Number 1 Region: 60-146
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.71e-21
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc06g084070.2.1
Sequence length 156
Comment genomic_reference:SL2.40ch06 gene_region:45616812-45617639 transcript_region:SL2.40ch06:45616812..45617639+ go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MEMAGTELRLGLPGTVPSSTSKISNKRCSSHRNNNDEPPQKAQVVGWPPVRSYRKNILEA
SYVKVSMDGAAYLRKIDLNTYKSYPQLLKALENMFKCSIDVYSETDGYNGCNYIPTYEDK
DGDWMLAGDVPWDMFINSCKRLRIMKGSEAKGLASL
Download sequence
Identical sequences G9HPV3
Sopim06g084070.0.1 Solyc06g084070.2.1 Solyc06g084070.2.1 NP_001266042.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]