SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g006760.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g006760.2.1
Domain Number 1 Region: 803-1071
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-76
Family Protein kinases, catalytic subunit 0.0000189
Further Details:      
 
Domain Number 2 Region: 38-127
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.15e-24
Family PB1 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc07g006760.2.1
Sequence length 1083
Comment genomic_reference:SL2.40ch07 gene_region:1599263-1605156 transcript_region:SL2.40ch07:1599263..1605156- go_terms:GO:0004712 functional_description:"Serine/threonine protein kinase (AHRD V1 *-** C4PKQ3_PRUPE); contains Interpro domain(s) IPR001245 Tyrosine protein kinase "
Sequence
MDSPTMTNPDSVSSSNDDTPRVKFLCSFSGSILPRPQDGKLRYVGGETRIVCVPRDISYD
ELMTKMREIYEGAMVLKYQQPDEDLDALVSVVNDDDVVNMMEEYDKLDSGDGFTRLRIFL
FLHPDQDGSLHFCDGDERENERRYVDVTGPLDDLHGAEQCFSQMTLDGCLHNLRSNEVPI
PQVNLRHLNIPHLGIAQPQQSVNQRYNEMEAPWSPAYYSPRQPGYLDPRPLSEFPNSPSS
SRYYSPYPEFQERNFDRLPEEYSRLQVNHPSLYDHQPQYADNVLLFPNGHVVDKAGFPGN
ILHGATAFEGNSICEHCRMTFQRNQPHPDSSWKPGEHSLLDTGNGFHQVANPCAECPPKR
EMFPVTTDASLHHSYYPVEQNDLRSRQSDIHSHERGWSVQHQSNARFEEPQIHASGAGSN
LVDGHQVLGQGLNNEDLRHIRTGRDPGSQVYHDQVVGTGSQIHLPSMEDRGVRYGNSPYA
YGPDTAYQVPQANMPAHSLWRNIQNPSHGGPSYEVGNSPQLVNGSASPGFVRGIMENGPR
LQSGMENQNAWLDSSQKKMVFDGFSIPEYSLAPSQNLISNAHNQGNQPMHTAEAIQAPGG
MQTVATLQDPVLKSDSGPFFGDRPATLSRSGIRLAADKCASEKESIRQEGEQLHTSGLAE
VSNICSSSPTKSLMDTIPLNHESPSTTCLENSVKEGVSADTETTDACVTYKNEKPLKDQL
TSLSDEIPSAEKVASQSVKDAKVKVQENADSTHEHDSAKVVHENDAELADDQGGLEFDSD
NDNVNNSKIESTKAEEEAIEKGLQTIKNEDLEEIRELGSGTYGSVFHGKWKGSDVAIKRI
KASCFAGRPSDRERLIADFWREALTLSSLHHPNVVSFYGVVRDGPDGSLATVTEFMVNGS
LKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPHRPVCKI
GDLGLSKVKQHTLVSGGVRGTLPWMAPELLSGKTKVTEKIDVYSFGIVMWELLTGDEPYG
DMHCASIIGGIVNHTLRPQIPTWCDPEWKALMESCWGPDPAERPSFSEISQKLRTMAAAM
NVK
Download sequence
Identical sequences K4CBE7
Solyc07g006760.2.1 Sopim07g006760.0.1 Solyc07g006760.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]