SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g007140.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g007140.2.1
Domain Number 1 Region: 1117-1387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-74
Family Protein kinases, catalytic subunit 0.0000245
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.71e-23
Family PB1 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc07g007140.2.1
Sequence length 1415
Comment genomic_reference:SL2.40ch07 gene_region:1889884-1899241 transcript_region:SL2.40ch07:1889884..1899241- go_terms:GO:0004712 functional_description:"Serine/threonine-protein kinase B-raf (AHRD V1 *-** BRAF_CHICK); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MAFDQNSVPKDLRPLNIVRTVPEESGIAPVTTSGRTVEGFYGNLTRDVGGSPGTIQGVYY
PTTVTDAGFVGLGYTNAGPGAAGWVPQVVASQPPGVVSVGVMNSGTGSSQNLHSVARVVS
NVSERASDDGGDGSVSGRKVKFLCSFGGRIIPRPSDGALRYVGGQTRIISVRRDVSFAEL
VRKMVDTCGQDVTIKYQLPDEDLDALVSVSCPEDLENMMDEYEKLVERASDGSAKLRVFL
FSASEVESSGLAQFGDLQDSGQRYVEAVNGISNGVSGIGLTRKGSNASAGSTQNSEFSGA
EAVDVLGHGQGELRAVPSFDTLSPSGTSATSQEPSYRLVSTDANPATHADASISSMPIPL
VVPGSVPTLSAQLEHGLEKTVPVTAQQQQMGYDMQQTGVTYQGTTAYFPAYVDPQRETVN
RTEYVQIPSQMGFPRQLLGTVGPVLNQQHIISGGPTQQFVPALHMTMAPSGHVSMNQNMV
ASQIQPQHFRLEHYPAEGTLGQRVVQIPVDQGYNAYQHHAPPAGLGGAYGWHHIPQTHQM
PLSEGQVPQPLVTGSEALPRFDDCLMCQKSLPHAHSDTVVQEQREIPASSVSDFNPVYHS
LRLDEMGHPIYRAVTTGTLGEPAIEQQGAAVGQRTGGQIDLGVGKGQGEVIGISQTVDKQ
YEYDRSLEQPEFAEHQKASVPSQGMIGLTGTVQPPYGVFVGAVPQPCHGNATEQLLVPSQ
YQVKQEVAANKPVSTDLLKVGSVPGQTLDNLSGESPKNYCGTAPTMLPKEDNIESLTAYN
HLRQIEGRMENLLMYPAEILANNEQSKPAVDNFRREDILNNRVQQFGGREVYPGLVTSNV
NPNEIPVSTHGNPFLPNIQAAEGYEVSQHPVMTNPGVHAQPNYGVNHLIPSEVSPHLTAL
SAHATERTPAIAEQKDGVQHFQPMVSPTTAEMTILDGTSPCVQENSNSLYSNQDPWNLHH
DSHFPPPKPSKLQLKKEAVGTKGENRFGNTNELPTTTNGGLQTQIRLEDGAYLPSGNTDY
SSDQSWSKKGSEEEMIKQELQAVAEGVAASVLQSSTPSNADLSSRGRSESPSSSQQNVEF
ESINAGKDPKDKFEETKTKFPERANFGFPVSGGIGRLQIIKNDDLEEIRELGSGTFGTVY
HGKWRGTDVAIKRINDRCFAGKASEQERMRDDFWNEAIKLADLHHPNVVAFYGVVLDGPG
GSVATVTEYMVNGSLRNALQKNERNLDKRKRLVIAMDVAFGMEYLHGKNIVHFDLKSDNL
LVNLRDPHRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSF
GIVLWELLTGEEPYAELHYGAIIGGIVSNTLRPPVPESCDPDWRSLMERCWSAEPSERPN
FTEIANELRVMQSKIPPKGQNQQSSPSANTNQAKT
Download sequence
Identical sequences K4CBI5
XP_004243022.1.44838 Solyc07g007140.2.1 Solyc07g007140.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]