SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g017510.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g017510.2.1
Domain Number 1 Region: 1495-1764
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.04e-80
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00028
Further Details:      
 
Domain Number 2 Region: 442-614
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.05e-42
Family Group II chaperonin (CCT, TRIC), apical domain 0.00052
Further Details:      
 
Domain Number 3 Region: 33-109
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Solyc07g017510.2.1
Domain Number - Region: 397-448,607-634
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00014
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc07g017510.2.1
Sequence length 1773
Comment genomic_reference:SL2.40ch07 gene_region:7403047-7425731 transcript_region:SL2.40ch07:7403047..7425731+ go_terms:GO:0016308,GO:0035091 functional_description:"Phosphatidylinositol-4-phosphate 5-kinase family protein (AHRD V1 **-* D7L328_ARALY); contains Interpro domain(s) IPR016034 Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup "
Sequence
MDTPENKKLSEIVDVVKLWMPRKTEAQVSVSRDFWMPDQSCRVCYECDSQFTVFNRRHHC
RLCGRVFCAKCASNSIPVSNEEPKAGQEDGDRIRVCSFCFKKWQQGLATVDSRMNLPCPG
LSPSPSTTSLASSQSGCTCNSGSSGSSTVYPTGPYQYVPCSSCQSASQSAQLGQAALQQD
QATSMGNPEFSHFISCYRSDDEDDDYGVCGSHSEPRHFTATDVYYGAFNYKEMNDICGPN
NGQPAEIESSSVNSSSLTENCEWKNSEGMKELAKEIDSCINRVEHEEPPPYDVNDTDNAP
VDFESSYLLWLPPEPETEEDDRESLSFDEDDDCSEEAPGEWGYMDSSWNLADGEYHNRST
AEHRKAMKNVVDGHFKSLIVQLLQVEHIPPAEEDNSESWSEIVTSLSWEAATLLKPDMSQ
NGGMDPCGYVKIKCIASGHRRESMVVKGVVCKKNVAHRRMNSKFKKPRLLILGGALEYQR
VANHLSSFDTLLQQEMDHLKMAVAKIDAHHPNILLVEKSVSRFAQEYLLVKNISLVLNVK
RPLLERIARCTGAQVVPSIDNLTTPKLGYCDSFHVDKFVEEHGSAGQAGKKLTKTLMFFE
GCPKPFGCTILLKGANGDDLKKIKRVIQYGVFAAYHLALETSFLADEGASLPELPLKSPL
KVALPDKPSTMQRSISVIPGFSVPVAQRPHDHHSPGTPSHSSTKPLSGITSPSNSAPMLV
EQSSFPECYNSLPSATTASNNVDFSDCPNSSHHSRRQFSDQADGRNEMAPNDPHEASPLD
RGEDARNDYILNFPSNSLRDTGSFSHVVGGFRTVHLSSELVLPEFDNSYFEELGSLQQDY
PSSPSDQLIIVVCLSTRCVWKGTVCEPPHISRIKFYGITDMPLGRFLRDRLFDENFRCPS
CEMPPEAHVRCYTHRQGSLTISVKKLPECILPGEQEGKIWMWHRCLRCPRDNGFPPPTRR
VVMSNAAWGLSFGKFLELSFSNHAAASRVASCGHLLHRDCLRFYGFGKMVACFRYAPVHV
YSVFLPPPKLEFSYDNQEWIQKEGDEVRRRANALFAEVSKVLHVKLEKFSVDSSLKAPKT
SEQITEMEEILEKEKTEFEGLLRKALSREIKVGQPTVDILEINQLRRQLVFHAYLWDRRL
IHLSSSHGKNSRTPGSLTQLKEKPLSSSEELPERTAILRPGKSLGSYDSALQNVKTEITS
SEGRHGQIPDGVHERLTTDENLTHGKDCEIFCAIRNTGDGNVLEPGKNVRRVLSDAKFPS
VGSLSDTLDAAWTGESHLAIKEHNSAFPGSFVVDSTALTGVSANTDVERSLCDKNGAEIP
HLSAKSDNTDYLTWATAHFSNFYRSFNKNITANPQYVAKLNEHNPVYILSFSELLHQGGA
RLLTAVGENDIVIPVYDDEPTSIISYALVSPDYRNQMSDESQNLKENHKFSASLSFLDSL
NLLPLHSVDGVVSESPRSFGSTNESMSSGYSSRSSNMDPPAYINALHARISFSDDGPPGK
VKYTVTCYYAKQFETLRKSCCPNESDFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQ
VTKTELESFIKFAPAYFKYLSDSIASGSPTCLAKILGIYQVTSKHLKGGKESRMDVLVME
NLLFKRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGTQAKRLLQRA
VWNDTSFLASIDVMDYSLLVGVDEKKQELVLGIIDFMRQYTWDKHLETWVKASGILGGPK
NAAPTVISPKQYKIRFRKAMSTYFLMVPDEWPT
Download sequence
Identical sequences K4CCG6
Solyc07g017510.2.1 Solyc07g017510.2.1 XP_010323385.1.44838 XP_010323386.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]