SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g019480.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g019480.1.1
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000114
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  Solyc07g019480.1.1
Domain Number - Region: 269-298
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00194
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc07g019480.1.1
Sequence length 323
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch07 gene_region:11723986-11725329 transcript_region:SL2.40ch07:11723986..11725329+ go_terms:GO:0006355 functional_description:"Unknown Protein (AHRD V1); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MLHILEGGSWSIICTIRTGNAKVYSGWKAFVLENKVIVDDVCVFELIKGAQLCVNIKIFC
AAGSTLMYDIVTKVPGVYDSKRKVIKVNNYIPSSQPKVVRIKELRHQARGSSGLNSKTKE
EHDKGTEIGHSVKILGHCRLGHGSKRKKPEKEIVDDVSVDVHTKSIKVEQSEEDVDSLSF
SRKLKKSGESFRMHTQQTEMAYAKRMTVLDKVRTIAYQRASFQILECICFNFYGAIICLK
TIQSGDLGMSNMTLGYQKKQSPYLEIVWLDNKLKIGDVCAFELIKRTQPFLDVTIFRAAE
KKPTHKIDEGVSDFKDKITKTRV
Download sequence
Identical sequences K4CCR0
Solyc07g019480.1.1 Solyc07g019480.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]