SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g006230.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g006230.2.1
Domain Number 1 Region: 41-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 158-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-16
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 3 Region: 250-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000106
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc08g006230.2.1
Sequence length 334
Comment genomic_reference:SL2.40ch08 gene_region:916374-919979 transcript_region:SL2.40ch08:916374..919979+ go_terms:GO:0003700 functional_description:"B3 domain-containing transcription factor VRN1 (AHRD V1 *-** VRN1_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MICNLGDLLIFKHEGDMEFESSSDCDENRFKETSNFSNRFSQVSILKIPIDFLKYLEGMN
HIKHAILKSMGKKWLVKVNGWRLEEGWEKFAEEHDLHLGDFLVFKHEGDMEFEVSIFDSS
HCDREYTEYLLEGVDNAEETFKKVKFKEAATHNCRGQSHYQCIVRPNYISNGYLRLPKHF
AIANGLTNKKCDLIVRDERQRSWNLRLVAYDSCVRVYGEWSNFCIVNNLKKGDYVTFEIV
PYGEKICKTSYLPMDFVKSNGLMSRSEMILIDEKQRSWSVWLGQTGHQFGIKRGWTQFRN
ANGIQLGDTYKFELTNNGTIPIAHVSILEVKGCE
Download sequence
Identical sequences K4CIB2
Solyc08g006230.2.1 Solyc08g006230.2.1 Sopim08g006230.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]