SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g008380.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g008380.2.1
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-40
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 572-654
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000981
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc08g008380.2.1
Sequence length 683
Comment genomic_reference:SL2.40ch08 gene_region:2808202-2812983 transcript_region:SL2.40ch08:2808202..2812983+ go_terms:GO:0003700,GO:0008022 functional_description:"Auxin response factor 9 (AHRD V1 **** D7R605_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MENQGSFMSNQQHQQHNFLAEGEDELCQELWRLCAGPLVDVPKNEERVYYFPQGHMEQLE
ASTNQELNQSIPLFNLQPKILCRVLHIQLLAEQDSDEVYAQIALLPEADQVEPTSPDLSL
PEPPRPKVHFFCKVLTASDTSTHGGFSILRKHANECLPPLDMTQATPAQELVAKDLHGFE
WHFKHIFRGQPRRHLLTTGWSTFVSSKRLVTGDSFVFLRSGKGEVRIGIRRLARQPSSMP
QSVISSQSMHLGVLATASHAVTTQTMFVVYYKPRTSQFIIGLNKYLEAVKHRYSVGMRFK
MKFEGEEIPEKRFTGTIVGVEDSSSQWKDSKWRSLKVQWDEPASVPRPDRVSPWDIEPFV
ASVATPLVPPMGVKNKRHRAHNEPKSSEPVPAAALAAWIPSAQFNPVIEGQSSDNPFSLH
TSQTNSTATNSTFKARVDGIWSASKVNASLNMLLDETEASKSASPRPAFPSFASSQFGKQ
NDLLLPSLDDERKCGTITSCRLFGIDLKCPSFGSVNENPPLEPANNSDGSAEGCSGNLTS
AGDSEDNSGLSRDSEDQKQEQLNPPPKEVHIKQVSSTRTRTKVQMQGVAVGRAVDLTKLN
GYDELLRELEELFDIQEELHARNKWEIVFTDDEGDMMLMGDYPWSEFCNIAKRIFICSSQ
DMKSFSAGTKSPSCLESETTAST
Download sequence
Identical sequences K4CIX2
Solyc08g008380.2.1 Solyc08g008380.2.1 XP_010324457.1.44838 XP_019070562.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]