SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g013690.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g013690.1.1
Domain Number 1 Region: 50-159
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-31
Family B3 DNA binding domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g013690.1.1
Sequence length 324
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch08 gene_region:3060068-3061042 transcript_region:SL2.40ch08:3060068..3061042+ go_terms:GO:0003700 functional_description:"Auxin response factor 24 (AHRD V1 *-** D9HNV1_MAIZE); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MNFFGSVVGEEEASSSSYNSQQLKRPSSSTTTELMLMDSSSTCDALVEREHMFDKVVTPS
DVGKLNRLVIPKQHAEKYFPLDSSSNNKGGLLLNFEDSNGKPWRFRYSYWNSSQSYVMTK
GWSRFVKEKKLDAGDVVSFQRGAGELSKHRLFIDWRRRPHHENGNNQFMLPHQFSDGRLF
YYPTTFSSNLLLEGGSNIVHPPNYYNPQSYMYEIGNRSYNISNGTVINANPLKNEIRWGG
CSSTTTTGNYVEPRVFDSVPVVQGKVAAKRFRLFGVNMDCPMDQDHPDTSSIPATTTVYS
YLNNNNSTPSEESSKKGKSFDLDI
Download sequence
Identical sequences K4CJ04
Solyc08g013690.1.1 Solyc08g013690.1.1 Sopim08g013690.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]