SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g068540.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g068540.2.1
Domain Number 1 Region: 267-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-23
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 11-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-16
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g068540.2.1
Sequence length 499
Comment genomic_reference:SL2.40ch08 gene_region:54893046-54896915 transcript_region:SL2.40ch08:54893046..54896915- go_terms:GO:0006355 functional_description:"B3 domain-containing protein At4g01580 (AHRD V1 *-*- Y4158_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MESCSNSYSAGSFYVIVEPSVMDDRQLRLPDKFVQEHGDELLDTVKIIVPTDDFWCVGLK
KAGKMIWLHDGWQEFMEHHSVNCWYFLLFKYGQTSCFNVHIFDLAATEIDYQLRSHGNAK
SRDVAQELSHRKDKIVGDKGFTSSIEIVDLLETEQGPESSAKSSELLHRAKRRKIASGKI
KITRCYETRSRTNKLHDNGQLLNAKNLNISGNGSLTKPVGGKSVRRSIKTPIHSAMATGD
TRKSFTSKQREKSLGRGRYDRRERAQQKILEKYNVERNYILNIPVEFVRKYMPKTSELIE
LQDTDGNKWKVRCIRRKLRVLLSKGWLNFVTDNSLLVGDVCVFELLKDVQAVELILKVHM
FRNRVEENSKNLHTGSLSEPTLSTGKNCILQFDESNHTKSSDAFKPLSSDRTNHKTDTEN
SFGQQQEKSVVHGSSGNRRKRGRPRDAEANTDTENSSGQQEEKSVVHGSLVIVVKEDDQG
MQKQTLIQRIHPDSKRRNP
Download sequence
Identical sequences K4CM78
Sopim08g068540.0.1 Solyc08g068540.2.1 Solyc08g068540.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]