SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g075900.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g075900.1.1
Domain Number 1 Region: 152-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000432
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g075900.1.1
Sequence length 259
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch08 gene_region:57150765-57151544 transcript_region:SL2.40ch08:57150765..57151544- functional_description:"B3 domain-containing protein At2g33720 (AHRD V1 *-*- Y2372_ARATH)"
Sequence
MIDDFLMLSLFPPLSEDNVIDAEPIRYHPSSSSSSTTLPSSAASSSTTYDFSSIDGGKDN
PNSPFLTLFTGVSKPIVNSTPPSSTDLCLSLPSLSNTSSTAQSSIDSQPSSSFASSSREV
NALGNSAPKRSLGEQKFIPRKKTKLTKGEEGHWMTKKLTRSDVNGASRLLLPRQDVNNYI
LPFMNEQERSVICQQLCGVDVTVFDMDTQTSHILTLEKWSTNSFHLVKAWTKDFVKRRND
EVSIRWEKTNSRFCFRVVN
Download sequence
Identical sequences K4CMV7
Solyc08g075900.1.1 Solyc08g075900.1.1 Sopim08g075900.0.1 XP_010325691.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]