SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g082630.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g082630.2.1
Domain Number 1 Region: 109-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-40
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 546-626
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000314
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc08g082630.2.1
Sequence length 644
Comment genomic_reference:SL2.40ch08 gene_region:62527536-62531812 transcript_region:SL2.40ch08:62527536..62531812+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 **** D7R605_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MNSPGKKDALYHELWQLCAGPVVDVPREGERVYYFPQGHMEQLVASINQEMDQRVPSFNL
KSKVLCRVINSHFLAEEDNDEVYVQITLMPEAPHVPEPTTPDPLIPQDVKPRFHSFCKVL
TASDTSTHGGFSVLRKHANECLPPLDLNQQTPTQELIAKDLHDVEWRFKHIFRGQPRRHL
LTTGWSTFVSSKKLVAGDSFVFLRGNNGQLRVGVKRLVRQQSSMPSSVMSSQSMHLGVLA
TASHAVTTQTMFVVYYKPRTTQFIVGVNKYLEALKHEYAVGMRFKMQFEAEGNPDRRFMG
TIVGIDDLSSQWKNSAWRSLKVRWDEPAAIARPDRVSPWEIKPYVCSIPNVLVPPTAEKN
KRHRLHSEIKISEQPSSSNASAVWNPSLRSPQFNTFGINSSTNCALASLTESGWQLPHLN
TSGMLVDEPEDGRSAPTWCGFPCVLAPQFGQGTNQPIVIPTDGRKCDTKKTCRLFGIDLK
SSSISTTEARLQLQPAGISCVFAERAPPNTVPAGDSDQKSELSVDFKDQMQGHLRLPLKE
VQSKQSCSTRSRTKVQMQGVAVGRAVDLTILKGYDELTKELEEMFEIQGELQSRQKWGIL
FTDDEGDTMLMGDYPWQDFCNVVRKIFICSSQDMKKLTLSRADS
Download sequence
Identical sequences D7R605
Solyc08g082630.2.1 NP_001234534.1.44838 Solyc08g082630.2.1 Sopim08g082630.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]