SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc09g064530.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g064530.2.1
Domain Number 1 Region: 188-293
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.77e-18
Family PB1 domain 0.022
Further Details:      
 
Weak hits

Sequence:  Solyc09g064530.2.1
Domain Number - Region: 119-197
Classification Level Classification E-value
Superfamily Indolic compounds 2,3-dioxygenase-like 0.0122
Family Indoleamine 2,3-dioxygenase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g064530.2.1
Sequence length 320
Comment genomic_reference:SL2.40ch09 gene_region:57405511-57410723 transcript_region:SL2.40ch09:57405511..57410723- go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 *-*- B3U2A2_CUCSA); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MRGTLGLMGFGGVTYGVSVDGSICTLSKEDNNGVLLSSEASSSYPDETQLELGLGLSLGA
SADVALPKAKTGARGGYAKILTPKKDFPSLGSNSSSSCSSSSVIKPNNASCGTKRNADSI
SPPRSSVSQVVGWPPIRTYRMNTLVNQTKLPPPEEFSVTNEKCKSKNTIANAGSSKINNF
AKEKGLVKASLFVKVNMDGVTIGRKVDLNAHNSYENLAQTLDNMFLRPSTTVCARSSNVQ
ELGVMSETTSSSRLLDGSSEFVLTYEDKDGDWMLVGDVPWEMFISSVKRLRVMRTSDANG
LGTSPTFMGRNGGRPGTKPI
Download sequence
Identical sequences K4CU81
Sopim09g064530.0.1 Solyc09g064530.2.1 Solyc09g064530.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]