SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc09g091180.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g091180.2.1
Domain Number 1 Region: 216-407
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.34e-78
Family GroEL-like chaperone, apical domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 38-165,437-553
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.06e-74
Family GroEL chaperone, ATPase domain 0.0000255
Further Details:      
 
Domain Number 3 Region: 169-235
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.12e-21
Family GroEL-like chaperone, intermediate domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc09g091180.2.1
Sequence length 579
Comment genomic_reference:SL2.40ch09 gene_region:65848356-65853683 transcript_region:SL2.40ch09:65848356..65853683+ go_terms:GO:0005524,GO:0005507 functional_description:"chaperonin (AHRD V1 ***- Q6N0B9_9PROT); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MYRFAANLASKASVARTSSQKIGGRLNWSRNYAAKDIRFGVEARALMLQGVEQLADAVKV
TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIQNVGASLVKQVANATNDVAGDGT
TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQVGT
ISANGERVIGDLIARAMEKVGKEGVITIQDGKTLLNELDVVEGMKLDRGYISPYFITNQK
NQKCELDNPLILIHEKKISSINAVVKALELALKRQRPLLIVAEDVDNEALATLILNKLRA
GIKVCAIKAPGFGENRKAYLQDLAILTGGQVITEELGLNIENLEFEMLGTSKEATISKDD
TVILDGAGEKKSIEERCELIRSTIEQSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEV
GEKKDRVTDALNATKAAVEEGIVPGGGVALLYAARELDNLTTANFDQKIGVQIIQNALKT
PVHTIASNAGVEGAVVVGKLLDQDNLDLGYDAAKGEYVDMIKAGIIDPVKVIRTALVDAA
SVSSLLTTTEAVVVELPKDEKESPAMGGGMGGGMGGMDF
Download sequence
Identical sequences K4CWE4
XP_004247810.1.44838 XP_015088355.1.21931 XP_015088356.1.21931 Solyc09g091180.2.1 Solyc09g091180.2.1 Sopim09g091180.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]