SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc10g075030.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g075030.1.1
Domain Number 1 Region: 319-421
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-19
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  Solyc10g075030.1.1
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0135
Family Erythroid transcription factor GATA-1 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc10g075030.1.1
Sequence length 879
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:58049176-58060149 transcript_region:SL2.40ch10:58049176..58060149+ go_terms:GO:0003700 functional_description:"AP2 domain-containing transcription factor (AHRD V1 *--* B9HWL7_POPTR); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MESKICMNGLCGTTSSIEWKKGWPLRSGEFATLCDKCGNAYEQLLFCDLFHSEDTGWREC
ISCGKRLHCGCIASSSLLELLDSGGINCISCVRSCQQHATPNHEKPKAFGTSISNSVGET
ASTSLGSQINGSEPNKREGSDSIDPALLLLHQNDNTNSPIGQIKMEETFHPAGESGSTFS
SNLFQASAEFSKNAKLDSYNGYKGVVEIHGSTVQTNLSIALSAPSPNSKLFPTTLDEGDL
NKTISSLQQGSRSRNLLPKPPKSASALGPEMNAGIISQIRVARPPVEGRIKNQLLPRYWP
RITDQELQQISGDSNSTIIPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLR
IQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLLMGFR
KASTVKITQENRLSAIPKNVFSTEPTSFSAMPENLPLMSGYSGLLQSFKGSRESSVNLSS
KHFNSGDFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLS
WEELQDMLRPPLSVQPTTVTIEDQEFEEYEQPPVLGKRSIFTVRLSGEQEQWAQCDNCFK
WRKLPADYLLPPHWTCQDNISDHSRSSCSIPDDLTPRELENLFKMDKDFKKQRSAAGQRI
TQAHDSSDLDSQANGISIAGDLGEPGPASVATTTKHPRHRPGCSCIVCIQPPSGKGKHNP
TCTCNVCMTVKRRFKTLMMRKKKRQSEREAELGQRNQLMWSSKEETEVDSFSRPVKPEVD
PSEKERSGSETLARGHSSYQLQKLPEITCLPLETYLRQNGLTSLVSEQQGSSGSQGLPQD
TRESDLRVQEDLCLASTAQEQEKDVPKENSEPDQTGKDQ
Download sequence
Identical sequences K4D1U5
Sopim10g075030.0.1 Solyc10g075030.1.1 Solyc10g075030.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]