SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc11g013480.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g013480.1.1
Domain Number 1 Region: 104-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-30
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc11g013480.1.1
Sequence length 342
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch11 gene_region:6508855-6511349 transcript_region:SL2.40ch11:6508855..6511349- go_terms:GO:0005634,GO:0006355 functional_description:"Auxin response factor 3 (AHRD V1 ***- A4L9W4_GOSHI); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MQAPTVADREVDPIVWRAIAGNSVKIPPVGTRVYYFPQGHAEHATFTSPAVMSPGMPAFI
LCRVLSVRFLAESDTDEVYARIFLHPISQSEVDEVTMREEEVVEDEIVSFVKILTPSDAN
NGGGFSVPRFCADSIYPRLDFEAEPPVQNLSIRDIKGVAWEFRHIYRGTPRRHLLTTGWS
KFVNSKQLVAGDSAVFMRRTANNQLYVGVRRAIRRNDDSQKWTSSFLMREHINNGGSPDV
SWGIRKGRMTMEAVAAVAEKAARGVPFEVSCYPRDAWAGFVVKAQEVQMALNMPWTVGMR
VKMAVEAEDSSRTACYQGTVSSVILNESGPWRGSPWRMLQII
Download sequence
Identical sequences K4D6F2
Solyc11g013480.1.1 Sopim11g013480.0.1 Solyc11g013480.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]