SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc11g044510.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g044510.1.1
Domain Number 1 Region: 252-355
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000314
Family B3 DNA binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 131-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000667
Family B3 DNA binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 4-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000902
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc11g044510.1.1
Sequence length 361
Comment evidence_code:10F0H0E1IEG genomic_reference:SL2.40ch11 gene_region:35859363-35860448 transcript_region:SL2.40ch11:35859363..35860448+ functional_description:"Unknown Protein (AHRD V1)"
Sequence
MKDHWPIKKALTLSDVDITHPFLTLSRQQVENHIVLHMTTEQQEHLRTQGQIDFNARDDD
TGKMYVMKLKWRGSYYNLIGKWGRVVRGKGLDVGQEIKIRWENGCFYFSVPKQQIVAVPP
IRMVAAPVVQDHWPIKKILTLSDVDTNHPFLPLPRRLVEDHILVHWTPQQQELLRKEEHV
NVNARDYDTGEGYIMKFKWRGNFYNLIGKWGAIIRQKGLGIGKEIRLRWENDCLFFSVPQ
ERYVATASAMDNWPIKKALTLSDVDTNHPFLTLPGKAVEDHILFYWSQQAREQLRNEHQM
NINARDDHTGDTYLMKLRWRGSYYNLIGKWGKIIRGKKLQVGMEIRLHWDNGCLFFSVPQ
L
Download sequence
Identical sequences K4D8B9
Solyc11g044510.1.1 Solyc11g044510.1.1 Sopim11g044510.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]