SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc11g045450.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g045450.1.1
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000235
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 228-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000294
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc11g045450.1.1
Sequence length 297
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch11 gene_region:37946628-37948736 transcript_region:SL2.40ch11:37946628..37948736+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At1g49475 (AHRD V1 *-*- Y1475_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MSHPKFIQIICSLDELYRLRIPPVFAESHCKDMLNHVFLQAPHGKAWEVEVEHSQGQIWL
AKGWKEFSNLYAISVKQLLMFTYNARDLLDVTIFGMDTVEIKYPIQDTESYDSMDIFYHS
TENLSHGPLVAKIIQKRQEGEEKDDIRLNLQTDANVIEGEEEYIPVNLQINANIIEEEEE
DIPVNLQTSANELAEEESQDQEVEEDNHRSEEVGQKNNNRHSVVNLADDTPYFEIVIKKT
HTTYLTIPIRFANRTNIVNMKNMRLVNGEGIRWGVEIEYTKCRAIIKKGWTEDGEWK
Download sequence
Identical sequences K4D8K9
Solyc11g045450.1.1 Solyc11g045450.1.1 XP_010313117.1.44838 Sopim11g045450.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]