SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc11g069000.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g069000.1.1
Domain Number 1 Region: 13-143,399-519
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.79e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00062
Further Details:      
 
Domain Number 2 Region: 206-372
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.07e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.00078
Further Details:      
 
Domain Number 3 Region: 152-212,365-399
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.25e-27
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc11g069000.1.1
Sequence length 526
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch11 gene_region:50652125-50657452 transcript_region:SL2.40ch11:50652125..50657452- go_terms:GO:0044267,GO:0006457 functional_description:"T-complex protein 1 subunit beta (AHRD V1 ***- B6T8X5_MAIZE); contains Interpro domain(s) IPR012716 T-complex protein 1, beta subunit "
Sequence
MAIDKLFKDEATEEKGERARMASFIGAMAIADLVKTTLGPKGMDKILQSTGRGHSVTVTN
DGATILKSLHIDNPAAKVLVDISKVQDEEVGDGTTSVVVLAGELLREAEKLVNAKIHPMT
IIAGFRMASECARNVLEQKVVDNKQDAEKFRSDLMNIARTTLSSKILSQDKEHFAKLAVD
AVMRLKGSTNLEAIQIIKKPGGSLKDSFLDEGFILDKKIGVGQPKRIENAKILVANTAMD
TDKVKIYGARVRVDSMAKVADLEAAEKEKMREKVQKIISHGINCFVNRQLIYNFPEELFA
DAGILAIEHADFDGIERLGLVTGGEIASTFDNPESVKLGHCKLIEEIMIGEDKLIHFSGV
AMGQACTIVLRGASPHVLDEAERSLHDALCVLSQTVNDSRVLLGGGWPEMVMAKAVDELA
KKTPGKRSHAIEAFTRALLAIPTTIADNAGLDSAELIAQLRAEHHKDESNAGIDVISGSV
GDMSELGISESFKVKQAVLLSATEAAEMILRVDEIITCAPRRREGM
Download sequence
Identical sequences K4DA57
XP_004251105.1.44838 XP_015058200.1.21931 Solyc11g069000.1.1 Solyc11g069000.1.1 Sopim11g069000.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]