SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc11g069790.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g069790.1.1
Domain Number 1 Region: 230-422
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.14e-72
Family GroEL-like chaperone, apical domain 0.00000249
Further Details:      
 
Domain Number 2 Region: 59-184,455-569
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.17e-63
Family GroEL chaperone, ATPase domain 0.0000739
Further Details:      
 
Domain Number 3 Region: 183-247
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000000000000158
Family GroEL-like chaperone, intermediate domain 0.0011
Further Details:      
 
Domain Number 4 Region: 407-454
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000394
Family GroEL-like chaperone, intermediate domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc11g069790.1.1
Sequence length 588
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch11 gene_region:51502451-51507359 transcript_region:SL2.40ch11:51502451..51507359- go_terms:GO:0044267,GO:0005737 functional_description:"chaperonin (AHRD V1 ***- B2IXD2_NOSP7); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MASANAISTASIIPSPSKQGGLKNRKVSQLQGQRFGNKGAKNRFVVKACAKEIAFDQKSR
SALQAGIDKLADAVGLTLGPRGRNVVLDEYGTPKVVNDGVTIARAIELPDAMENAGAALI
REVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVLGLIEELEKK
ARPVKGRDDIKAIASISAGNDESIGTMIADAIDKVGPDGVLSIESSSSLETTVHVEEGME
IDRGYISPQFVTNPEKLISEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDI
TGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEYQATDLGLLVENTPV
EALGIARKVTITKDSTTIIADAASKDEIQSRIAQLKKELSETDSVYDSEKLAERIAKLSG
GVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEGIVPGGGAAFVHLSTYVPAIKEKIE
DADERLGADIIQKALVAPASLIAQNAGVEGEVVVEKVKEAEWEMGYNAMTDQYENLVEAG
VIDPAKVTRCALQNSASVSGMVLTTQAIVVEKPKPKVAAPAAPQGLQV
Download sequence
Identical sequences K4DAD5
Sopim11g069790.0.1 XP_004251160.1.44838 XP_015058097.1.21931 Solyc11g069790.1.1 Solyc11g069790.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]