SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc12g049590.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g049590.1.1
Domain Number 1 Region: 1501-1768
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.49e-80
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00041
Further Details:      
 
Domain Number 2 Region: 442-614
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.2e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.00024
Further Details:      
 
Domain Number 3 Region: 31-102
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Solyc12g049590.1.1
Domain Number - Region: 398-448,607-630
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00223
Family GroEL-like chaperone, intermediate domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc12g049590.1.1
Sequence length 1801
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch12 gene_region:46677541-46688352 transcript_region:SL2.40ch12:46677541..46688352+ go_terms:GO:0044267,GO:0008270,GO:0046488 functional_description:"Phosphatidylinositol-4-phosphate 5-kinase family protein (AHRD V1 **-- D7L328_ARALY); contains Interpro domain(s) IPR016034 Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup "
Sequence
MDATNRTLSDLLKLLKSWIPWRSEPDDISRDFWMPDHICRVCYECDSQFTLFNRRHHCRL
CGRVFCAKCTSNWIPALCSDPRPLREEWEKIRVCNYCYKQWDQGLVSSVSNGTRVANLHI
CTSPSTTTSFTSFKSSGTADSSNITFVSVPPSCVLSPCKSSVTESSLDRQNYASVRGSFE
FAHAGVLDPSLNQYAFCATRSDDEEDEYGVYQLDSQGHFPQVNDYYSQIQYDEIKKDYGS
HKEHPDGEAIDEKSVSSSSLHNSFDSQASEEVQQIEKQDISDECEVPPSLNVPEEINVEP
VDFDNNGLLWIPPEPEDQEDEKEALMNDDDDDGDAAGEWGGLRSSSSHGSGEYRSRDRSN
EEQKKVVKNVVDGHFRALVSQIMQAQGVAIDEEDEKESWLEIITSLSWEAATLLKPDTSR
SGGMDPGGYVKVKCIASGRRGDSVVVKGVVCKKNVAHRRMTSKIEKPRILILGGALEYQR
VSNHLSSFDTLLQQEMDHLKMAVAKIDVHQPDVLLVEKSVSRYAQEYLLAKDISLVLNIK
RTLLERIARCTGSQIVPSIDHFSSKKLGFCDMFHVEKFIEEHGTAGQNGKKLAKTLMYFE
GCPKPLGCTVLLRGANGDELKKVKHVFQYSIFAAYHLALETSFLADEGASLPELPLNSSI
TVALPDKSSTIGRSISVVPGFTIHDTEKTQSALCDGAPQRSNSVPTTDLVKTANLCAQKM
SMTEFPTAANTETSFLGPLLTGTSVDRGIMHMIESSFSKPSVANNIQDSQGYHFLSTSSA
PSDKVEQGCLSKNVQNCRVDVNQRGANPILSQLDGPNVYDEPDSSKEEFPPSPSDHQSIL
VSLSSRCVWKGTVCERSHLFRIKYYGNCDKPLGRFLRDNLFDQSYRCSLCDMPSEAHVQC
YTHRQGTLTISVKKLPEFLLPGEREGKIWMWHRCLRCPRVDGFPLATQRVVMSDAAWGLS
FGKFLELSFSNHAAASRVASCGHSLHRDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLD
FNDEKNQDWIQQEVNEVIVRAERLFSEVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQI
AVLEGMLRKEKEEFEESLQKILNKEAKKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAA
SLECEDHCVTEEKPLVGNDKSTGPDNPSRPSDCLNVIDSVSVTPILGEKYNDGVSGSQKN
HVDTVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLS
DTLEAAWTGETTSGPGVLKDGTCRSSEPPIADSSTTRLAEKVDVEDPVEENGTKASGFPP
SLSSKSSESAEDAGGWLGMSFISFYWSLNKNFLPSAQKLDTLGEYSPVYISSFRESEAQG
GARLLLPVGVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPEKSKDASLYSNLPLQSQ
ESGSLQSLQSMDEILSESLRSLGSIDESFLSSSSSHSSSVLDPLSCTKTMHARVSFSDDG
PLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKKWGAQGGKSNVFFAKTLDDRF
IIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKILGIYQVTSKHLKGGKESKLDV
LVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQNLIESMPTSPIFVGNKAKRL
LERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDFMRQYTWDKHLETWVKASGIL
GGPKNTPPTVISPKQYKKRFRKAMTTYFLMVPDHWSPLTITPNKSQNDLSGENTLSVKST
E
Download sequence
Identical sequences K4DFN9
XP_004252409.1.44838 XP_010314337.1.44838 Solyc12g049590.1.1 Solyc12g049590.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]