SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g097910.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g097910.2.1
Domain Number 1 Region: 107-173
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.17e-19
Family Rubredoxin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g097910.2.1
Sequence length 206
Comment genomic_reference:SL2.40ch01 gene_region:80353631-80354713 transcript_region:SL2.40ch01:80353631..80354713+ go_terms:GO:0046872 functional_description:"Rubredoxin family protein (AHRD V1 *-*- D7KP11_ARALY); contains Interpro domain(s) IPR004039 Rubredoxin-type Fe(Cys)4 protein "
Sequence
MASATSRASFTFNLSSSPSLTQPSTLKTKTHLTLPPFHIKSHSVSSFYRYPKPQFNLQPK
SIDVSQEDKPISEQPITETPTSESEQEQEEEEKFDSRRLEEKFAVLNTGIYECRSCGYKY
NEATGDPSYPIPPGLPFDKLPEDWRCATCGAAKSFFDSKSVEIAGFAQNQQYGLGGNTLT
SGQKALLIYGGLLLGFVFFLSGYFLQ
Download sequence
Identical sequences K4B0H8
Sopim01g097910.0.1 Solyc01g097910.2.1 XP_004230127.1.44838 Solyc01g097910.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]