SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g106230.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g106230.2.1
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-20
Family B3 DNA binding domain 0.00037
Further Details:      
 
Domain Number 2 Region: 227-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-17
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g106230.2.1
Sequence length 336
Comment genomic_reference:SL2.40ch01 gene_region:85950723-85962787 transcript_region:SL2.40ch01:85950723..85962787- go_terms:GO:0006355 functional_description:"B3 domain-containing protein At5g60142 (AHRD V1 *-*- Y5142_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEKGFVKIFSPENSGKRLKIPTSFTYYKNRKLPMKINLRDRFGNMWPVGVNKIGGNLYFQ
YGWEKFIEDNSVEVGDFLVFDYDGNKMFDFKLLGRTKCEKNGVGGLKAEEMIVEHQKSRE
SKEKNWASDSCNSFSSYDNDVEYMGERDEDEDEDEDKDEEYKETKKVACYVEDEEEDDED
EEEEDEGENQRTNTHKKEALRSKAFACKVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRS
KRRDQLYVPVDVVKDYKLELPSSMTIRDSIGREFVTKLNKWKDGRIWLVGGWRSLCRWNL
VEKNDHCICEFVRGKRNKDLHLRVQVLREGESSVTL
Download sequence
Identical sequences K4B2J3
Solyc01g106230.2.1 Solyc01g106250.2.1 XP_004230633.2.44838 XP_004231373.1.44838 XP_019067400.1.44838 XP_019067402.1.44838 Solyc01g106230.2.1 Solyc01g106250.2.1 Sopim01g106230.0.1 Sopim01g106250.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]