SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g108940.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g108940.1.1
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-17
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 231-313
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000726
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g108940.1.1
Sequence length 372
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch01 gene_region:87825683-87830031 transcript_region:SL2.40ch01:87825683..87830031+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os11g0197600 (AHRD V1 *-*- Y1176_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEKGFFRIFNPESSAKRMKIPSSYATYKNGKLPRNVFFRDRFNNMWPMGVTKIEGALYFE
NGWKKFIEDNNTLEYGDFMIFDYDGNETFDFKVLEMSGCVKEGAKCEKKKEVYVEHRKSV
EPKEKNRIGDNNDSSSDDDNANNYMIEEEESNVKEEVEKEEEEDREEKETMEEVEDEAEE
EEDEEEIETTQTFKKRRSGSKAGRRKAITCKVRNMIDRHGIDIFRSGSATKPKNPYFVAK
IIAKRRNQQYVPIDVVRDYKLELPPSMIIRDSAGREFETKVKYWKDGRIWLVGGWRSICR
WNLVEKNDSLQFTTRIFSNNGLERQVKSTDMIKNQQASIYDRGSSVKGQKNTLTLQNSLN
RLLLTVKATQLK
Download sequence
Identical sequences K4B3A8
Sopim01g108940.0.1 Solyc01g108940.1.1 Solyc01g108940.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]