SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g108950.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g108950.1.1
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.39e-17
Family B3 DNA binding domain 0.00067
Further Details:      
 
Domain Number 2 Region: 236-331
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-17
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g108950.1.1
Sequence length 347
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch01 gene_region:87833474-87835392 transcript_region:SL2.40ch01:87833474..87835392+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os11g0197600 (AHRD V1 *-*- Y1176_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEKGFFKAFNPQTSAKRMKIPTAYTNYKNGKLPRKVFLRNQFSNMSWPVRVIKIEKDLYF
LNGWEKFIEDNNLEFGNIIIFDYDGNEIFDIKLLEPNGCIKNGAKCDNKKEEVNVEHQQS
IEPKEKNKTRDNNNSSFDDDSTDNYMVEEEDNDEEEVENEEEEDNEQKGEEKETEEEVDE
GEEDETEEEVVERKENETDGEDTSASKAGRRKAITCKVRNVHDKYGADIFRSGRATQPKN
PYFVAKMRAKMRNQLYVPIDVVRDYKLELPPTMIIRDSVGREFETKVNKWSNGTTWLVGG
WRNLCRWNLVEKDDRCICEFVRGKCGRVLYLQIQVLYEGSNSHRNNK
Download sequence
Identical sequences K4B3A9
Sopim01g108950.0.1 Solyc01g108950.1.1 Solyc01g108950.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]