SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g109030.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g109030.2.1
Domain Number 1 Region: 110-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000053
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g109030.2.1
Sequence length 208
Comment genomic_reference:SL2.40ch01 gene_region:87868255-87870761 transcript_region:SL2.40ch01:87868255..87870761+ functional_description:"B3 domain-containing protein REM5 (AHRD V1 *-*- REM5_ARATH)"
Sequence
MAKLCRWNLVEKDVKCICEFVKGKGNKVLYLQVQVLHEGSVSNSNTRHMEDEDEDNDDEE
EEETEEDERTGTFKKNVSRSEVGCKRDTACKVRDIPDQYGADIFKSGCATQPKNPYFVAK
IRAKRRDQLYISIDVVRDYKLELPSRMIIRDSADREFETKLKNWKDGRIWLAGGWRSLCR
WNLVEKDDRCICDCERKRQKKPLFAMKY
Download sequence
Identical sequences K4B3B7
Solyc01g109030.2.1 Solyc01g109030.2.1 Sopim01g109030.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]