SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g021260.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g021260.1.1
Domain Number 1 Region: 179-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 611-710
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-20
Family B3 DNA binding domain 0.0079
Further Details:      
 
Domain Number 3 Region: 395-495
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-19
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 4 Region: 1209-1312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.92e-18
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 5 Region: 1014-1115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000167
Family B3 DNA binding domain 0.013
Further Details:      
 
Domain Number 6 Region: 831-888
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000314
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc02g021260.1.1
Sequence length 1317
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch02 gene_region:13096096-13102938 transcript_region:SL2.40ch02:13096096..13102938+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein LOC_Os12g40080 (AHRD V1 *-*- Y1208_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MASSSSTKNNTVVQSRFIKIILFPHECIHLSIPHDFERRCCNDILSPVHLEVPTGQVWEV
ELRHSEAEIEYPYSSRTFHFHETHHAPIIDLSESDVDIMEDTPRRQKLKEKVVDHSLENL
CYGQISKRKRHGDDVASPSFTKKVQNCRIHKKDSKSVYDQNKTVMEKESSTAYQQAKAFK
SKNPFIISFMQPSYVSASFNLSIPLKFARKYFLENNGNLVLRVPGIGSWSVKCTLGMTNG
KVGSGWKAFVQDNKLKVGDVCVFEVLKGQLFVDVIIFRAAGSTLMHNIVAEVPRVPCSQP
KVVQTKKSKQHTGGSYGLNLKIKEEQGEGTEILGHCPSGRGSKRKQPEVDAVVPSFTKKA
QNCRIHKKDSKSVYDQNKTVMEKESSTAYQQAKAFKYKNPFTISFMQPSYVSASFNLSIP
LKFARKYFLENNGNLVLRVPGIGSWSVKCTLGMTNGKVGSGWKAFVQDNKLKVGDVCVFE
VLKGQLFVDVIIFRAAGSTLMHNIVAEVSRVPYSQPKVVQTKKSKQHTGGSYGLNLKIKV
EQGEGTEILGHCPSGRGSKRKQSEVDAVVPSFTKKAQNCRIHKKDSKSVYDQNKTVMEKE
SSTAYQQAKAFKSKNPFTISFMQPSYVSASFNLSIPLKFARKYFLENNGNLVLRVPGIGS
WSVKCTLGMTNGKVGSGWKAFVQDNKLKVGDICVFEVLKGQLFVDVIIFRVAGSTLMHNI
VAEVPRVPCSQPKVVQTKKSKQHTGGSYGLNLKIKEEQGEGTEILGHCPSGRGSKRKQPE
VDAVVSSFTRKTKKSGGSCGLHKKQSKIVYDKNKTVTDKKSSIAYQRAKAFKSKNPFIVS
FMQPSYISKHYILKIWSAFARKYFLENDGNLVLRVSGSGSWSVKCTITTAMIKGGQLFVD
VTIFRAAGSIIVAEVPGRSDRKSKVIKEEHGKGTEIEHSVKVLGHCPLGNDSKRRRPARK
AEDVASPSFTRKPKKSGESCRMHKQQTKMVNAKRKTVLDKEMTIAYQRAKAFRSKNPFVI
YFMQPSYVSRPYNLHMTFSYAQKYLWEKCGDLVLRAAGRGSWSVKYDLGLPEGRIRLSWR
AFVLDNKLKSGDVCVFELIKGTQPFLDVIIFRANERKPKHTTDGGVSGFRNKIIKTENSV
PCPRTKIDHSRKHNLEKKHKGDSDGFITSKVKEELREGTLRHGQQSTSFCMGTVVAKEMV
LAYQKAKAFTSENPFFLSFMQPSYVSLARGPIQLSIASSVARKFFSTRQSDVVLEVSSKR
RWTVKCSVGIKTAKFSCGWKEFVVDNKLKVGDVCIFEWTGRPNLVFNVIIFPSCGGI
Download sequence
Identical sequences K4B4X6
Solyc02g021260.1.1 Solyc02g021260.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]