SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g032220.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g032220.1.1
Domain Number 1 Region: 175-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000785
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc02g032220.1.1
Sequence length 293
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:18720896-18721777 transcript_region:SL2.40ch02:18720896..18721777- functional_description:"B3 domain-containing protein At3g25182 (AHRD V1 *-*- Y3518_ARATH); contains Interpro domain(s) IPR005508 Protein of unknown function DUF313 "
Sequence
MEDDVDGGSKEESCITDFECIDVEEREKEEAFRKNPFMCEHSIDHYYYLLPRAKRSRIFR
RNNPPPTVMPSQSMSQKKGLKIRISLKSKTIEEVDQDLSMEKNKTQTLFGEKQSKLEDRE
KKTETVLDEKQSKAKDRKRKRRKICKPIIDPPVLPDELKEMISGMGVQISQVKLVIQKVL
YDTDLSYKQVRLSIPINQVENKDFLTPQQKMVLETRDIVSNKKSKIQFNLIEPSLEKTKI
HLAKWDMSNTSNYVLLNGWMQVVERNILKSGMVVQLWSFNQDLVPWLALVLVR
Download sequence
Identical sequences K4B5G8
Solyc02g032220.1.1 Sopim02g032220.0.1 XP_004231679.1.44838 Solyc02g032220.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]