SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g037530.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g037530.2.1
Domain Number 1 Region: 112-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 714-790
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000105
Family PB1 domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g037530.2.1
Sequence length 842
Comment genomic_reference:SL2.40ch02 gene_region:21756443-21766699 transcript_region:SL2.40ch02:21756443..21766699+ go_terms:GO:0003700 functional_description:"Auxin response factor 8 (AHRD V1 **** A7L5C4_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MKLSTSGMGQQAHEGGEKKCLNSELWHACAGPLVCLPTVGSRVVYFPQGHSEQVAATTNK
EVDAHIPNYPNLSPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKDTYLPVEFGIP
SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPAQELIARDLHDVEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAVRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSCFNVFFNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGIGDLDPVRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYPSLFPLRLKRPFYQGTSSYQDSNNEAINRMSWLRGNAGELGHHSMNLQSFGMLP
WMQQRVDSTILPNDINQHYQAMLATGLQSFGSGDLLKQQLMQFQQPVQYLQHASTENSIL
HQQQQQQQQIMQQAVHQHMLPAQTQMLSENLQRQSQHQSNNQSEEQAHQHTYQEAFQLPH
DQLQQRQPSNVTSPFLKADFADLTSKFSASVAPSGVQNMLGSLCSEGSNNSLNINRTGQS
VIIEQSPQQSWMSKFTESQLNTCSNSSSLPTYGKDTSNPRGNCSLDSQNQALFGANIDSS
GHLLPTTVSNVTTTCADMSLMPLGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVK
VYKSGCVGRSLDITQFHSYHELRRELGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGD
DPWEAFVNNVWYIKILSPEDVQKLGKEEAESLNRGAVERMSSTNADDRDLISGMPSLGSL
EY
Download sequence
Identical sequences K4B5U7
XP_004231633.1.44838 Solyc02g037530.2.1 Solyc02g037530.2.1 Sopim02g037530.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]