SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g065310.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g065310.1.1
Domain Number 1 Region: 107-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-21
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g065310.1.1
Sequence length 227
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:31073379-31074625 transcript_region:SL2.40ch02:31073379..31074625- go_terms:GO:0003700,GO:0016564 functional_description:"B3 domain-containing transcription factor VRN1 (AHRD V1 **** VRN1_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MLIFYLVEKSTFHVLHYSKKPRTNIRHFEELSSEDEVENVEEKEDEEENVEASRKSKKVK
TEPKESSAIDNEGCKMQSQQSSVIYDVRKTVMDKEKAIAYQRAKATFKSKNPFFISFMHP
SYISRSSNHLCIMLRFARTYIPENCSNIMLRVAGRGSWPVTYSTGKAQAKISIGWEAFVL
DNKLKVGDVCVFEVIKGTQIFMNVTIFRAAGSMPMQETDGQFVVSFH
Download sequence
Identical sequences K4B6W5
Solyc02g065310.1.1 Sopim02g065310.0.1 Solyc02g065310.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]