SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g079020.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g079020.2.1
Domain Number 1 Region: 318-416
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g079020.2.1
Sequence length 1043
Comment genomic_reference:SL2.40ch02 gene_region:38216434-38227691 transcript_region:SL2.40ch02:38216434..38227691- go_terms:GO:0005515,GO:0003700,GO:0016564 functional_description:"AP2 domain-containing transcription factor (AHRD V1 *--* B9HWL7_POPTR); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MSSSAAASGNVCFNSNCKEFVEKTRKGWRRRTGEFAELCDRCGSAYDDGKFCDAFHLNSS
GWRSCESCGKQIHCGCIVSFHTFVLLDAGGIECIACARKSFILPERIKDVNNWNPIAGSG
PVPWRQAPSLFNGSTNQNELQHKAPFPEATVSIDRLSLGERPFALLSDNNRKDSCEKLMN
GKLKIGVPGTPEDGYAGSNRDEAHKSCLSAPWQSSYANSELSAPSFCLTVGSASKNEPTV
HSKVSVSVPQKTTLSIPLPLGKQLGGHATVDSAGETQVKSSKIRGDGRGKNQLLPRYWPR
ITDQELRRLSEDSNSVITPLFEKMLSASDAGRIGRLVLPKKCAEAYFPPISNPEGLPLKM
QDLKGKEWMFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRIEPEGKLVMGCRK
ASNILTADQGSEACSNGNGVATNGNASTKHTKSSEEVLANSTKKGSSSTTLVAATSARAE
IKMSDDLVNESLGTNRPIRCKRKGSTMGSKRKRMRIDNDNLVELKVTVVQAQGLMRPPSS
GAPTVIVIEGCEFEEYEQEDAPIIGRPTIPHMDQLGEKIQWVQCEDCFKWRKVPDNVDLP
SRWTCSDNSCDPERSVCSAVQELTADHLRDLLPHINKASKKRKASKQEMDLVETLDGLDA
LAHLAILEEGETLPASPQATTKHPRHRPGCTCIVCIQPPSGKGPKHKQSCDCNVCKSVKR
RFKTLMMKREKKLSEKEAEATCQKLQPQSAGQLLDADDIQEPIDDAVHSSPQHEELNIEG
SVDPNYLNEKKSSVEDPNYLDEKKSSVDDTNYLSEKISSVDDPSYLNEKESSVDDPNILN
EKKSSVDDPNCLNEKKSAVDDPNYVDERKSSVDDPNCLKEKKSSASPFKGEFDLNAKPDR
DDELSPGSDSGSMMRMIKRAAEQYVRHCDNGSSVGNQRDGDGAGETNPGNCVIVSGSHQA
DVDHNRPLPISAAASLAPNDQLHFAMAASMSETHKFWESNGDLNLEIVLEEQPLVTERRV
LSIVYMVVSLLDLIWDSKLVGLD
Download sequence
Identical sequences K4B9C6
Solyc02g079020.2.1 Solyc02g079020.2.1 Sopim02g079020.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]