SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g081780.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g081780.1.1
Domain Number 1 Region: 189-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-16
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000184
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g081780.1.1
Sequence length 293
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:40179674-40180844 transcript_region:SL2.40ch02:40179674..40180844- go_terms:GO:0006355 functional_description:"B3 domain-containing protein At5g18000 (AHRD V1 --*- Y5800_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MLMDSDNTPAFCKLLQFGEVFISKMMPSCFIKENKKMLTKACLLKTDEAGMLWEAKIVRE
KSNNYFICEGEWPQFVVHHQLKQGDVLLFFLVEKSVFHVHPYTRKCRRNIRDEKKKLFYQ
QLSSTSSSSSSEEVEIGPDRKVNSTDEESVDEDDSPCYKNPKQENLSDDGGGGNGSKKFR
GGSSMMNFKTDHPYYEMVVKRSHKTFMTIPKRFAKMTGIFSMKNMKVVNEEKKGYWRVEI
VDMSGTIRITKGWAAFRTYNKIVCGDSCRFKLIKPNTLQVQKVPKHASLKSYH
Download sequence
Identical sequences K4BA48
Sopim02g081780.0.1 Solyc02g081780.1.1 Solyc02g081780.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]