SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g093660.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g093660.1.1
Domain Number 1 Region: 72-151
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000981
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 235-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000373
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g093660.1.1
Sequence length 385
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:49008583-49009992 transcript_region:SL2.40ch02:49008583..49009992- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MSGLRDQLLEKNEISDSYYHVDQHSDSMKVEEQNNDSCDNLDNSENDSLQTKHSTGSPVD
TGTAWVYRDENGKQFFEKQLSEDDITGDHLEIPRRLAHYIQSLKLKRRVNAGEKTRKVNL
VGENECYYFTGQWKDFVMENQLKAHKDLVLLEISQQLGLRIGHTCDQKAIDMNNPVLLRR
LSRADVKALYIKKLSERYSFSRGATGLIEIEPVVEMKLCSQIVYRYGGRTNGVMFIELPK
KDVEENLGRDLPLPAAGGDIALPLFDPVGNNLVEMKLLHTEIGDQYHLGGGWEVYAAKHG
LLISDTIFLDKVTVQVGNDHDQLNTAQFSCHYEITYQRRRRGGTKDHSGSAAPANSVKDV
VRVTKIISESSEYEGDSSWLQYCTP
Download sequence
Identical sequences K4BDG2
Solyc02g093660.1.1 XP_010315947.1.44838 Solyc02g093660.1.1 Sopim02g093660.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]