SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g083110.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g083110.1.1
Domain Number 1 Region: 169-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.59e-28
Family B3 DNA binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 47-98
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000445
Family GCC-box binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g083110.1.1
Sequence length 335
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch03 gene_region:46473739-46475572 transcript_region:SL2.40ch03:46473739..46475572+ go_terms:GO:0003677,GO:0016564 functional_description:"AP2 domain-containing transcription factor (AHRD V1 **** B9IMF3_POPTR); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEDETNLISSTTNVTVGDCDSSGSNHLLPKKRNINNAREGKCCISGSKFKGVVGQNNGHW
GAQIYANHQRIWLGTFKTETDAAMAYDSAAIRLLGPDHSHRNLSWTNSTIQEPNFQTQFS
TEDILRMIKEGSYTSRFDEYLKDKFEDHFQSLKNLQKVNEGNAEFSYKQLFQKELTPSDV
GKLNRLVIPKKYATKYFPQIQDEEMIFYDTSRRLWKFRYCYWKSSQSFVFTKGWNKFVKD
KGLRAKDTIVFNLCEFKNGTKENCNAFVIDVVKSIDGVPMNLALNHHEQEETIDDHEVDT
QEFTKAQPFDDDLVPVWLFGKQIGWMETKGAMEFN
Download sequence
Identical sequences K4BI87
Solyc03g083110.1.1 Solyc03g083110.1.1 XP_010318116.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]